PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00359g05021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family CO-like
Protein Properties Length: 318aa    MW: 35599.6 Da    PI: 5.2592
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00359g05021.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.54.9e-071253439
                  zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                              r+C+++ +   + +C+ ++ +lC+ C   +H        H++
  Peinf101Scf00359g05021.1 12 RVCDTCRSAACTVYCRADSAYLCAGCDARIHAAnlvasrHER 53
                              79******99*********************65677777765 PP

2zf-B_box30.48e-105499342
                  zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                               ++C+ +e+ ++ + C+ +   lC++C + +H+       H +vp+
  Peinf101Scf00359g05021.1 54 VWVCEACERAPAAFLCKADAASLCASCDSDIHSAnplarrHHRVPI 99
                              689*****************************66899999877775 PP

3CCT70.25.1e-24249292144
                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                               Rea++lRY+eK+k+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Peinf101Scf00359g05021.1 249 REARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 292
                               9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003368.9E-9956IPR000315B-box-type zinc finger
PROSITE profilePS5011910.153956IPR000315B-box-type zinc finger
CDDcd000213.51E-71256No hitNo description
PROSITE profilePS5011911.1495299IPR000315B-box-type zinc finger
PfamPF006431.2E-75399IPR000315B-box-type zinc finger
CDDcd000211.98E-85599No hitNo description
SMARTSM003363.2E-95799IPR000315B-box-type zinc finger
PROSITE profilePS5101716.638249291IPR010402CCT domain
PfamPF062036.6E-18249291IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MLKKESSNNW ARVCDTCRSA ACTVYCRADS AYLCAGCDAR IHAANLVASR HERVWVCEAC  60
ERAPAAFLCK ADAASLCASC DSDIHSANPL ARRHHRVPIM PIPGTEDDGF LTTPDDEETI  120
DEEDEDEAAS WLLLNPPPVK NNNNNNKNNI NNNQSNNNYG MLFGGEVVDD YLDLGEYSPC  180
QDSQFTDQYS VNHQQQNYSV SMSSMDVSVV PESALSETSN SHPRPPKGTI DLFSGPPVQI  240
PQQLTPMDRE ARVLRYREKK KNRKFEKTIR YASRKAYAET RPRIKGRFAK RTDVEAEVDQ  300
MFSTQLIADS SYGIVPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001233839.11e-171CONSTANS 1
SwissprotQ965021e-126COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLQ2VY101e-171Q2VY10_SOLLC; CONSTANS 1
STRINGSolyc02g089540.2.11e-171(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52482337
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.17e-99CONSTANS-like 2